Art vs. Science

From Matty Phillips June 02, 2021

52 plays 0 comments You unliked the media.

Leonardo Di Vinci once said “Study the science of art. Study the art of science…Realise that everything connects to everything else.”

However, most modern-day curricula and education systems keep science and the arts very separate.

In this video, Alison speaks to Tony Ryan, Professor of Physical Science at the University of Sheffield about why these two disciplines are kept apart and what binds them together.

They also discuss Tony’s project Catalytic Clothing, as well as his collaboration with English Language and Literature Professor Joanna Gavins and poet Simon Armitage ‘In Praise of Air.’ Both of these projects use artistic design to achieve scientific outcomes around air purification.

Tags: futurelearnmakerspacemakerspacesmakeyfutures

Looking for more...

Comments
Related Media

Loading…

Art vs. Science

Related Media